Tag Archives: Selbstverwirklichung

Bildung Karriere Schulungen

Persönliche Weiterentwicklung? Aber bitte individuell!

Die Expertinnen und Experten für intrinsische Motivation zeigen, was die persönliche Weiterentwicklung mit dem Reiss Motivation Profile® ermöglicht

Persönliche Weiterentwicklung? Aber bitte individuell!

Daniele Gianella der RMP germany über persönliche Weiterentwicklung.

Selbstverwirklichung ist ein großes Wort – und ein erstrebenswertes Ziel für viele. „Um dem Wunsch der Selbstverwirklichung nachkommen zu können, bedarf es persönlicher Weiterentwicklung“, erklärt Daniele Gianella der RMP germany. Er sieht sich in seiner Beratertätigkeit als Gefährte seiner Kundinnen und Kunden, um sie auf ihrem individuellen Weg zum Erfolg zu begleiten.

„Damit sich ein Mensch persönlich weiterentwickeln kann, muss er sich selbst gut kennen. Er muss wissen, wer er ist, was er will, wohin ihn sein Weg führen soll und was ihm Zufriedenheit schenken kann“, betont Gianella. Antworten darauf liefert laut dem Experten das Reiss Motivation Profile®: „Steven Reiss hat mit seinem Reiss Motivation Profile® 16 grundlegende Lebensmotive entdeckt, mit denen menschliche Motivation messbar und erklärbar wird. Mithilfe dieses Modells bekommen Menschen tiefgreifende Erkenntnisse über ihre Persönlichkeit, ihre Motivatoren, ihre Ziele, Emotionen und Wünsche.“

Besonders wichtig sei, dass dabei auch das Warum eines Menschen definiert werden könne. „Genau das ist ein wichtiger Faktor und Treiber, wenn es um die persönliche Weiterentwicklung geht“, sagt Gianella. Mit dem Wissen um das Warum kann ein Mensch in die Selbstanalyse gehen. Und er kann achtsamere und klarere Entscheidungen treffen. „All das mündet darin, dass er vermehrt nach seinen Motiven lebt, sein Verhalten danach ausrichtet, Störfaktoren erkennt und minimiert und seine zu ihm passenden Ziele fokussierter verfolgt.“

Dies sei für die persönliche Weiterbildung grundlegend, denn so kenne sich der Mensch nicht nur selbst besser, er lerne auch sein Umfeld neu kennen und entwickle mehr Verständnis für seine Mitmenschen. „So kann er sich ein passendes Umfeld schaffen oder suchen, Energie zielgerichtet einsetzen, leistungsfähiger sein und sich ganz nach seiner individuellen Persönlichkeit nachhaltig weiterentwickeln“, schließt Gianella.

Mehr zum Reiss Motivation Profile®, der RMP germany und Daniele Gianella finden Sie unter: www.rmp-germany.com

Wir von der RMP germany verstehen uns als Expertinnen und Experten für intrinsische Motivation und sind seit dem 01.07.2017 exklusiver Lizenzpartner in Deutschland für das Persönlichkeitsprofil Reiss Motivation Profile®. Wir ermöglichen Anwenderinnen und Anwendern individuellen Erfolg noch schneller und nachhaltiger sichtbar zu machen. Als Repräsentanten von Steven Reiss möchten wir als RMP germany das Reiss Motivation Profile® allen Menschen auf der Welt zugänglich machen und unterstützen damit die Vision des 2016 verstorbenen Psychologen und Wissenschaftlers, der das bekannte Persönlichkeitsprofil entwickelte. RMP germany: reflect – match – perform.

Kontakt
RMP germany GmbH
Benjamin Schulz
Aarstraße 6
35756 Mittenaar-Bicken
02772 5820-123
mail@rmp-germany.com
http://www.rmp-germany.com

Computer IT Software

Trend: Digitale Selbstverwirklichung mit eigener Website

Trend: Digitale Selbstverwirklichung mit eigener Website

Eigene Website erzeugt positive Emotionen

-Umfrage von GoDaddy und YouGov belegt: Mehr Menschen bauen eine Website – 22 Prozent der Deutschen haben schon eine Idee ins Netz gebracht
-39 Prozent half die eigene Website, sich selbst zu verwirklichen
-Website mit starken Emotionen verbunden: Zufriedenheit (45 Prozent), Stolz (37 Prozent) und Glück (30 Prozent)
-Glücksexperiment soll Erkenntnisse vertiefen

Köln, 17. Mai 2018: Mit sinkenden technischen Hürden bauen immer mehr Menschen eine Website: 22 Prozent der Deutschen haben schon selbst eine Idee ins Netz gebracht, zwei Drittel davon sind Männer, ein Drittel Frauen. Für viele Website-Betreiber trägt dieser Schritt erheblich zur Selbstverwirklichung und gar zum eigenen Glück bei. Das zeigen Ergebnisse einer von GoDaddy und dem Forschungsinstitut YouGov durchgeführten repräsentativen Umfrage. Zur Vertiefung dieser Ergebnisse startet GoDaddy, die weltweit größte Cloud-Plattform für Kleinunternehmen, ein Glücksexperiment.

Von den Befragten mit eigener Website betreiben 57 Prozent eine private Seite, 23 Prozent nutzen sie für die eigene Selbständigkeit. Der Großteil verfolgt demnach private Zwecke (53 Prozent), gefolgt von Werbezwecken (23 Prozent), dem Einsatz als Online-Visitenkarte (18 Prozent), gemeinnützigen Zielen (14 Prozent) und Verkaufsabsichten mit einem Online-Shop (13 Prozent).

Unabhängig vom Zweck können von der eigenen Website starke positive Impulse für das eigene Leben ausgehen: Für 56 Prozent der Website-Betreiber war es ein erfüllendes Projekt, eine Website selbst zu gestalten. 39 Prozent bestätigen, dass ihre Website ihnen dabei half, sich selbst zu verwirklichen. Für ein Viertel der Website-Besitzer war der Effekt so stark, dass sich mit dem Start der eigenen Website ihr Leben zum Positiven verändert hat.

Wer einen eigenen Webauftritt gestaltet hat, verknüpft mit deutlicher Tendenz positive Emotionen mit der eigenen Website. Bei der Auswahl aus einer Liste von zehn positiven und sieben negativen Gefühlen verbinden die Website-Starter am häufigsten Zufriedenheit (45 Prozent), Stolz (37 Prozent) und Glück (30 Prozent) mit dem Moment des Onlinegehens. Auch bei der Frage, mit welchen Emotionen sie heute an ihre Website denken, liegen die positiven Assoziationen ganz vorne – mit leicht geringeren Zustimmungsraten.

„Aus der Positiven Psychologie wissen wir, dass unsere Lebenszufriedenheit zur Hälfte genetisch bestimmt wird, 40 Prozent können jedoch durch eigenes Handeln beeinflusst werden“, erklärt Glückswissenschaftlerin Saskia Rudolph. „Das Entwerfen und Erstellen einer Website regt die Kreativität an und fördert die eigene Motivation, wie die Ergebnisse der Umfrage zeigen. Hier arbeiten Menschen also aktiv an ihrem Glück. Das belegt auch die Tatsache, dass sich die meisten in der Rückschau als „zufrieden“ mit ihrer persönlich wichtigsten Website bezeichnen: Da über die Zeit extreme Gefühle eher nachlassen, sich hier aber eine langanhaltende Zufriedenheit eingestellt hat, ist dies ein positiver und psychologisch gesunder Trend.“

„Durch meine Arbeit, aber auch im privaten Umfeld habe ich schon viele schöne Geschichten erlebt, die ihren Ausgangspunkt in einer neuen Website fanden: Ein Motorradshop, der mit seinen aufwendig restaurierten Bikes viele Liebhaber im Netz begeistert, oder ein Freund, der mir aufgeregt den Link zu seiner neuen Website schickte, die für ihn den Schritt in die Selbständigkeit bedeutete. Daher habe ich damit gerechnet, dass Menschen Stolz und Zufriedenheit mit ihrem Webprojekt verbinden. Doch dass die eigene Website bei vielen so starke Emotionen wie langanhaltendes Glück auslöst, hat uns überrascht. Diesen Effekt wollen wir im Glücksexperiment, das wir aktuell durchführen, genauer untersuchen“, kommentiert Paul Ashcroft, Group Marketing Director von GoDaddy.

Anfang des Jahres startete GoDaddy offiziell in Deutschland mit dem Website Builder, der es Nutzern erleichtert, ihre Online-Präsenz zu erstellen und zu verwalten. Außerdem bietet das Unternehmen eine Reihe von integrierten Online-Produkten, einschließlich Domain-Namen-Registrierung, Hosting und E- Commerce, zusammen mit Produktivitäts- und Sicherheitsschutz-Tools, um Online-Unternehmen beim Wachstum zu unterstützen.

Zur Methodik:
Die Daten basieren auf einer gemeinsamen Umfrage von YouGov und GoDaddy. An der Befragung im März 2018 nahmen 2.037 Befragte aus Deutschland im Alter ab 18 Jahren teil. Davon haben 22 Prozent bereits eine eigene Website erstellt. Ausgenommen sind Teilnehmer, die Websites beruflich erstellen. Die dargestellten Ergebnisse beruhen auf den Angaben derjenigen 439 Personen, die bereits mindestens eine Website erstellt haben und dies nicht beruflich tun. Die Ergebnisse sind für diese Gruppe repräsentativ nach Alter, Geschlecht und Region.

Über GoDaddy:
GoDaddy ist die größte Cloud-Plattform weltweit, die sich auf kleine, unabhängige Unternehmen konzentriert. Mit mehr als 17,5 Millionen Kunden weltweit und mehr als 76 Millionen verwalteten Domains ist GoDaddy der erste Ansprechpartner für Menschen, die ihrer Idee einen Namen geben, eine professionelle Website erstellen, Kunden gewinnen und ihre Arbeit produktiver gestalten wollen. Unsere Mission ist es, unseren Kunden die richtigen Tools, Know-how und die Unterstützung an die Hand zu geben, um ihre Ideen und Projekte erfolgreich zu machen. Weitere Informationen unter https://de.GoDaddy.com

Firmenkontakt
GoDaddy Deutschland GmbH
Celia Gastaldi-Höppner
Hansestraße 111
51149 Köln
0049 (0)30 61625555
godaddy@frische-fische.com
https://de.godaddy.com

Pressekontakt
Agentur Frische Fische
Celia Gastaldi-Höppner
Schlesische Str. 28
10997 Berlin
+49 (0)30 6167 5555
cg@frische-fische.com
http://www.frische-fische.com

Mode Trends Lifestyle

Mehr Lebensqualität erzielen

Kleine Änderungen mit großer Wirkung – Life Coach Anja Faras erklärt, wie jeder für sich selbst mehr Lebensqualität erreichen Kleine Änderungen mit großer Wirkung – Life Coach Anja Faras erklärt, wie jeder für sich selbst mehr Lebensqualität erreicht

Mehr Lebensqualität erzielen

Life Coach Anja Faras verhilft Menschen mit ‚The Art of Living‘ zu mehr Lebensqualität.

„Viele Menschen leben in Mustern oder Systemen, die sie aber eigentlich gar nicht wirklich zufrieden und glücklich machen – obwohl sie scheinbar alles haben“, konstatiert Anja Faras, die als Life und Sport Mental Coach mit „The Art of Living“ Menschen dazu verhilft, dasjenige Leben zu führen, das sie auch führen möchten. Dabei sei es völlig egal, ob man daran glaubt, nur ein Leben zu haben oder nicht, alle wünschten sich mehr Lebensqualität und möchten sich ihr Leben so schön gestalten wie möglich.

„Die meisten Menschen wissen aber überhaupt nicht, was für sie persönlich Lebensqualität eigentlich ausmacht, geschweige denn, wie sie ein Plus an Lebensqualität erreichen können,“ erzählt Faras, der diese Problematik in ihrer Arbeit als Life Coach immer wieder begegnet. „Ein gut bezahlter Job, viel Freizeit, gute Gesundheit, eine tolle Partnerschaft, Familie oder einfach Selbstverwirklichung – was Lebensqualität ausmacht, ist komplex und bedeutet für jeden etwas anderes.“ Mit ihren Coachings und auch mit ihren kostenfreien Blogs unterstützt sie Menschen dabei, genau das herauszufinden.

Der Schlüssel zu mehr Lebensqualität besteht ihr zufolge immer in Veränderung. Doch die Angst vor Veränderung und Folgen, die zum jetzigen Zeitpunkt noch nicht absehbar sind, halten viele Menschen davon ab, etwas zu verändern. „Neues, Ungewisses und nicht zu wissen, was geschieht, kann natürlich sehr beängstigend wirken und Menschen darin hemmen, ihre Lebensqualität zu verbessern“, beschreibt Faras. Das seien aber meist nur im Kopf konstruierte Ängste, die zu einem Katastrophendenken führen. In der Regel treten diese Katastrophen gar nicht ein.

Außerdem sei der Irrglaube, für mehr Lebensqualität müssten die Veränderungen sehr drastisch oder tiefgreifend sein, weit verbreitet. „Es muss nicht immer gleich ein Job gewechselt oder umgezogen werden“, erklärt Faras. Selbstwirksamkeit und Selbstverwirklichung beginne bereits im Kleinen. In den meisten Fällen reiche es daher bereits, Unzufriedenheit und Wünsche konkret anzusprechen und gemeinsam nach einer Lösung zu suchen.

Ihr Tipp: „Fragen Sie sich ganz gezielt, was Ihnen im Leben wichtig ist und sprechen Sie mit denjenigen Menschen, die das ebenfalls betrifft, darüber. Sie werden erstaunt sein, was für einen positiven Effekt das zur Folge haben kann.“ Denn: „Jeder ist für sein Leben verantwortlich und kann es verändern. Man muss sich nur trauen“, so Faras abschließend.

Weitere Informationen zum Thema sowie zu Anja Faras – The Art of Living – finden Sie unter www.anja-faras.de

Ob im Business, im Sport oder im Alltag – Anja Faras begleitet als Life Coach und Sport Mental Coach Menschen dabei, ein Leben mit mehr Lebensqualität zu führen. Durch ihre Faszination für Sport und ihre Begeisterung für Fußball hat Faras schon früh erkannt: Wer mental stark ist, kann Höchstleistung auf den Punkt abrufen. Wer mental stark und fokussiert ist, kann gelassen und souverän Herausforderungen angehen und sein Know-how abrufen, wenn es gebraucht wird. Anja Faras bietet neben Life Coaching und Sport Mental Coaching außerdem Workshops und Vorträge zum Thema an. Ihr Credo: Leben Sie das Leben, das Sie leben möchten!

Kontakt
Anja Faras – The Art of Living
Anja Faras
Neckartal 180
78628 Rottweil
+49 (0) 151 544 094 14
info@anja-faras.de
http://www.anja-faras.de

Kunst Kultur Gastronomie

Jetzt ist die Zeit für Träume(r)!

Neuerscheinungen aus dem Verlagshaus serendii

Jetzt ist die Zeit für Träume(r)!

Wo Träume(r) einander guten Tag sagen…

Im fruchtbaren Tal des Dreamicon Valley sind sie entstanden; die beiden Neuerscheinungen, die auf ganz eigene Weise das Thema Träume behandeln.

Zum einen ist da „Freiraum für Träumer“, ein Buch zweier Absolventinnen der Graphischen Versuchs- und Lehranstalt in Wien, das dem Träumen auf den Grund geht um dann Träumerinnen und Träumer vor den Vorhang zu holen, die es geschafft haben, ihre Lebensträume tatsächlich umzusetzen.

„Freiraum für Träumer“
von Judith Kaiser und Victoria Herold
ISBN: 978-3-9504217-6-7

„Die Wüstenpflanze“ als actionreicher Roman malt eine Zukunft aus, in der es einem japanischen Jung-Wissenschaftler gelingt, durch seine Erfindung dem Klimawandel ernsthaft die Stirn bieten zu können; zynischerweise jedoch zum Missfallen eines mächtigen und nicht minder skrupellosen Unternehmens.

„Die Wüstenpflanze“
von Thomas Sailer
(überarbeitete Neuauflage)
ISBN: 978-3-9504217-3-6

Pressematerial sowie weitere Informationen zu unseren Autorinnen und Autoren und dem Verlagsprogramm finden Sie in unserem Pressebereich: http://serendii.com/presse-serendii

Für Rückfragen und Interviewanfragen steht Ihnen das Team von serendii publishing gern zur Verfügung!

Ihr Team von serendii publishing

7011 Siegendorf, Industriegebiet 1,
Innovation & Technology Tower, Top 2
www.serendii.com info@serendii.com

Überall auf der Welt schlummern Potenziale in Menschen, die oft nur der richtigen Motivation, Inspiration oder auch einer Information bedürfen, um Großartiges entstehen zu lassen. Wir sehen es als unsere Aufgabe als Verlag, diesen Potenzialen und Ideen, die einen positiven Einfluss auf die weitere Entwicklung unserer Welt üben wollen, als Bücher in die Welt zu bringen um so ebenfalls einen wichtigen Beitrag zur positiven Entwicklung unserer Gesellschaft zu leisten.

Kontakt
serendii publishing
Wolfgang Stricker
Industriegebiet 1
7011 Siegendorf
004369917114545
info@serendii.com
http://www.serendii.com

Wirtschaft Handel Maschinenbau

Das Sabbatjahr als Motivationskick für Mitarbeiter

Aktuelle Studie: Wie bewerten Unternehmen das Recht auf Auszeit?

Das Sabbatjahr als Motivationskick für Mitarbeiter

Die Mehrheit der Unternehmen steht dem Recht auf ein Sabbatical positiv bis neutral gegenüber.

Mehrere Monate Auszeit nehmen um zu reisen, sich weiterzubilden oder sich um die Familie zu kümmern – davon träumen viele Arbeitnehmer. Dieser Wunsch könnte nun leichter Realität werden, denn die Politik diskutiert ein Gesetz, das jedem das Recht auf zwei Sabbatjahre im Laufe der Karriere einräumen würde. Aber wie reagieren die Arbeitgeber auf diesen Vorschlag? Die aktuelle Randstad-ifo-Personalleiterbefragung hat herausgefunden: erstaunlich gelassen. 82% der Personaler sind grundsätzlich offen für das Sabbatjahr, 26% rechnen sogar mit einem positiven Effekt für das Unternehmen. Sie versprechen sich vor allem motiviertere Mitarbeiter.

Laut dem Gesetzesvorschlag stünden jedem Arbeitnehmer gesetzlich zwei Berufsunterbrechungen von je maximal einem Jahr zu. Die Pausen sollen für diverse Aktivitäten wie zum Beispiel Auslandserfahrungen, persönliche berufliche Weiterentwicklung oder Familienzeit genutzt werden können. Während des Sabbaticals verzichten die Arbeitnehmer auf ihr Gehalt oder lassen sich angesparte Überstunden auszahlen.

56% der befragten Unternehmen stehen diesem Modell neutral gegenüber: Sie erwarten dadurch keine unmittelbaren Konsequenzen für ihren Personalstand. Am ehesten findet das Recht auf Auszeit Zuspruch im Verarbeitenden Gewerbe, wo 29% für den Vorschlag sind. Unter den Dienstleistern sind es 27%, der Handel ist mit 22% etwa skeptischer. In allen Branchen rechnen die Fürsprecher damit, dass die Angestellten voller Tatendrang zurückkehren und eventuell neue Kompetenzen – persönliche oder professionelle – in den Job einbringen. „Ein Angebot für ein Sabbatical kann für Arbeitnehmer eine zusätzliche Motivationsquelle sein und zur Mitarbeiterzufriedenheit beitragen, da es Vertrauen signalisiert. Die Studienergebnisse zeigen, dass viele Personalleiter dem Konzept offen gegenüber stehen“, so Petra Timm, Director Group Communications bei Randstad.

Zur Randstad-ifo-Personalleiterbefragung
Die in Zusammenarbeit von Randstad und dem ifo-Institut entwickelte Randstad-ifo- Personalleiterbefragung zeigt die langfristige Bedeutung und Funktion von Flexibilisierung im Personaleinsatz. Dazu werden vierteljährlich mehr als 1.000 Personalleiter befragt. Im Rahmen der Sonderfrage werden zusätzlich aktuelle Personalthemen aufgegriffen. Mehr Informationen und den kompletten Berichtsband der Studie zum Download gibt es unter www.randstad.de/publikationen

Mit durchschnittlich rund 58.000 Mitarbeitern und rund 500 Niederlassungen in 300 Städten sowie einem Umsatz von rund 2,1 Milliarden Euro (2016) ist die Randstad Gruppe der führende Personaldienstleister in Deutschland. Randstad bietet Unternehmen unterschiedlicher Branchen umfassende Personalservice-Konzepte. Neben der klassischen Zeitarbeit gehören zum Portfolio der Randstad Gruppe unter anderem die Geschäftsbereiche Professional Services, Personalvermittlung, HR Lösungen und Inhouse Services. Mit seinen passgenauen Personallösungen ist Randstad ein wichtiger strategischer Partner für seine Kundenunternehmen. Durch die langjährige Erfahrung unter anderem in der Personalvermittlung und Personalüberlassung sowie individuelle Leistungs- und Entwicklungsangebote für Mitarbeiter und Bewerber, ist Randstad auch für Fach- und Führungskräfte ein attraktiver Arbeitgeber und Dienstleister. Als Impulsgeber für den Arbeitsmarkt hat Randstad bereits im Jahr 2000 einen flächendeckenden Tarifvertrag mit ver.di abgeschlossen, der als Grundlage für die geltenden tariflichen Regelungen in der gesamten Branche diente. Randstad ist seit knapp 50 Jahren in Deutschland aktiv und gehört zur niederländischen Randstad Holding nv: mit einem Gesamtumsatz von rund 20,7 Milliarden Euro (Jahr 2016), über 620.000 Mitarbeitern täglich im Einsatz und ca. 5.800 Niederlassungen in 40 Ländern, ist Randstad einer der größten Personaldienstleister weltweit. Zur deutschen Randstad Gruppe gehören neben den Unternehmen Randstad Deutschland GmbH & Co KG auch die Unternehmen Tempo Team, Gulp, Monster, twago, Randstad Sourceright, Randstad Outsourcing GmbH sowie Randstad Automotive und Randstad Financial Services.

Firmenkontakt
Randstad Deutschland
Petra Timm
Helfmann-Park 8
65760 Eschborn
06196/4081770
06196-408 1775
presse@randstad.de
http://www.randstad.de

Pressekontakt
Randstad Deutschland Pressestelle
Helene Schmidt
Helfmann-Park 8
65760 Eschborn
06196/4081701
06196-408 1775
helene.schmidt@randstad.de
http://www.randstad.de

Bildung Karriere Schulungen

Die Bequemlichkeits-Falle

Life Coach Anja Faras gibt Tipps, wie man ein selbstbestimmtes Leben führen kann

Die Bequemlichkeits-Falle

Selbstverwirklichung ist ihr Spezial-Gebiet: Life Coach und Sport Mental Coach Anja Faras

Jeder Mensch kommt im Laufe seines Lebens mindestens einmal an einen Punkt, an dem er sein Leben reflektiert und sich fragt: Lebe ich eigentlich das Leben, das ich leben will? Bei relativ vielen Menschen heißt die Antwort trauriger Weise „Nein“, weiß auch Life Coach und Sport Mental Coach Anja Faras aus ihrer Praxiserfahrung. „Es gibt viele Menschen, die unglücklich sind und das Gefühl haben, im falschen Leben zu leben“, so Faras. Das sei aber noch lange kein Grund, den Kopf in den Sand zu stecken. Die Expertin für mentale Stärke weiß, wie man sich selbst verwirklichen und sein Leben dahingehend verändern kann, dass es für einen selbst das „richtige“ Leben ist.

Oftmals wurden die Weichen für die Unzufriedenheit schon in Kindheit und Jugend gestellt. „Wenn wir uns das erste Mal fragen müssen, wohin unsere Reise gehen soll, haben die meisten noch keine Ahnung davon, was sie wollen. Vieles ist durch das Elternhaus, durch die Schule und die Werte, die dort gelebt werden, geprägt“, so Faras. Diese Werte werden dann einfach weitergelebt und sind so verfestigt, dass es vielen Menschen schwerfällt, sich aus diesem Konstrukt wieder herauszubewegen.

Zunächst heißt es Mut aufbringen, denn „Viele Menschen trauen sich gar nicht erst, solche Dinge anzusprechen. Aber nur, wenn ich etwas anspreche, kann ich auch nach Lösungen suchen. Dieses „etwas aushalten müssen“ ist leider weit verbreitet,“ weiß die Expertin. Viele Menschen leben daher unter ihrem Potenzial, weil sie glauben, sie müssten etwas aushalten. „Dadurch begibt man sich in eine Fremdbestimmung, aus der man wieder raus muss. Es läuft dann alles auf die Frage hinaus: Was will ich eigentlich?“

Um das herauszufinden, benutzt Anja Faras in ihrem Coaching dafür häufig das Sinnbild eines Biotops: „Ich frage meine Coachees, wie ihre persönliche Wohlfühl-Umgebung aussieht. Was brauchen sie, um wachsen und gedeihen zu können? Was sind ihre Bedürfnisse?“ Weiterhin gilt es herauszufinden, was Menschen konkret davon abhält, sich zu verändern. Und wer oder was ihnen bei Veränderungen helfen könnte. „Jeder muss sich fragen: Was könnte im schlimmsten Fall passieren? Und im besten? Denn nur wer sich Klarheit verschafft, kann etwas verändern und ein selbstbestimmtes Leben führen“, schließt Anja Faras.

Weitere Informationen über Life Coach und Sport Mental Coach Anja Faras – The Art of Living finden Sie unter: www.anja-faras.de.

Ob im Business, im Sport oder im Alltag – Anja Faras begleitet als Life Coach und Sport Mental Coach Menschen dabei, ein Leben mit mehr Lebensqualität zu führen. Durch ihre Faszination für Sport und ihre Begeisterung für Fußball hat Faras schon früh erkannt: Wer mental stark ist, kann Höchstleistung auf den Punkt abrufen. Wer mental stark und fokussiert ist, kann gelassen und souverän Herausforderungen angehen und sein Know-how abrufen, wenn es gebraucht wird. Anja Faras bietet neben Life Coaching und Sport Mental Coaching außerdem Workshops und Vorträge zum Thema an. Ihr Credo: Leben Sie das Leben, das Sie leben möchten!

Kontakt
Anja Faras – The Art of Living
Anja Faras
Neckartal 180
78628 Rottweil
+49 (0) 151 544 094 14
info@anja-faras.de
http://www.anja-faras.de

Wissenschaft Technik Umwelt

Mein Engel wacht im Küchenschrank

Du bist nicht allein!

Mein Engel wacht im Küchenschrank

Cover

Eine luftig-leichte Selbstfindungsgeschichte

Als der Engel der Wahrheit, Gabriel, in das Leben der Geschäftsfrau Lucy Einzug erhält, macht sie es sich zur Aufgabe, nur noch die reine Wahrheit zu sagen. Sie beginnt, ihr Aussehen zu verändern und stößt damit nicht nur auf Gegenliebe, sondern bald auch an ihre Grenzen.

Mit einem Augenzwinkern lädt Charlotte Stern ihre Leserinnen und Leser dazu ein, die Welt der Engel kennenzulernen und sich selbst zu finden. Liebevoll und mit viel Humor gewährt sie einen Einblick in ihre Erfahrungen und Phantasien mit den himmlischen Helfern, um Lebensmut, Vertrauen und Zuversicht zu schenken. Die Autorin ist sich sicher: „Engel geben uns Halt inmitten einer unsicheren Welt und sind das Spiegelbild unserer Sehnsucht nach Spiritualität und Hilfe von einer höheren Macht.“

Die Verantwortung für unser Handeln liegt dennoch ganz in unserer Hand.
Wer sich schon einmal über die Engel-Begeisterung, bis hin zur „Besessenheit“, seiner Mit-Menschen gewundert und sich gefragt hat, wozu das alles denn dienen soll, findet in diesem Büchlein möglicherweise seine ganz eigenen Antworten.

Über die Autorin

Geboren 1972, wuchs Charlotte Stern im Süden von Bayern auf. Sie studierte Philosophie und Sprachen. Durch verschiedene Auslandsaufenthalte vertiefte sich ihr Interesse an unterschiedlichen Kulturen, Meditation und Spiritualität. Ihre Neugier und Offenheit führten sie dazu, sich mit den Mechanismen des Verstandes, aber auch der magischen Welt der Engel zu beschäftigen, die sie immer stärker in ihren Bann zog.

tao.de ist das Selfpublishing-Portal, das AutorInnen mit den Themengebieten Neues Bewusstsein, Ganzheitliche Gesundheit und Spiritualität bei allen Schritten von der Idee über die Produktion von Büchern und ebooks bis zu ihrer Vermarktung begleitet. tao.de ist ein Selfpublishing-Portal der J.Kamphausen Mediengruppe.

* Die J. Kamphausen Mediengruppe mit den Verlagen J.Kamphausen, Aurum, Theseus, Lüchow, LebensBaum und der Tao Cinemathek sowie den Selfpublishing Portalen tao.de und Meine Geschichte wurde 1983 in Bielefeld gegründet. Das Lieferprogramm umfasst mehr als 1.000 Titel aus den Themenbereichen ganzheitliche Gesundheit, Persönlichkeitsentwicklung und Wirtschaft. Einzelne Titel erreichen Auflagen in Millionenhöhe.

Firmenkontakt
tao.de
Kirstin Dreimann
Goldbach 2
33615 Bielefeld
0521-560 52 13
0521-560 52 29
info@j-kamphausen.de
http://www.weltinnenraum.de

Pressekontakt
J. Kamphausen Mediengruppe GmbH
Julia Meier
Goldbach 2
33615 Bielefeld
0521-560 52 232
0521-560 52 29
julia.meier@j-kamphausen.de
http://www.weltinnenraum.de

Bildung Karriere Schulungen

Berufswahl: Was wird aus mir wenn ich groß bin?

Kindergarten, Schule, Abschluss und dann? Viele Jugendliche stehe vor dieser spannenden Frage. Welcher Lebensentwurf passt? Studium, Ausbildung, Travel and Work oder Lebenskünstler? Diskussionsbeitrag von Norbert Hahn, Hahn Fertigungstechnik GmbH

Berufswahl: Was wird aus mir wenn ich groß bin?

Was wird aus mir wenn ich groß bin? Spanende Bearbeitung einer Buchse – Hahn Fertigungstechnik GmbH

Was im Leben anfangen – welchen Beruf wählen?

Was waren die Zeiten noch einfach, als der Sohn das wurde was Papa war und die Töchter sich an ihren Müttern orientiert haben!? Die Qual der Wahl: Beruf und Job, Chancen und Karriere, Glück, Sinn und Lebensinnhalt? Hahn Fertigungstechnik GmbH sucht jedes Jahr Auszubildende. Möchte jungen Menschen die „Chance Azubi“ einen Platz zur Ausbildung bieten. Mit der qualitativen Ausbildung des Nachwuchses trägt das Unternehmen Hahn zur Zukunft der Auszubildenden und der Betriebe bei. Wichtigster Motivator liegt in der Weitergabe des umfassenden fachlichen Know-Hows, beruflichen Weiterbildung, Sicherheit zum Wohlstand und an der Mitgestaltung der Zukunft. Wie junge Menschen zur Ausbildung und der Berufswahl motivieren? Norbert Hahn, Geschäftsführer der Hahn Fertigungstechnik GmbH in Papenburg an der Ems im Nord-Westen Niedersachsens, sieht Diskussionsbedarf zu Thema Berufswahl und Fachkräftemangel.

Stellenwert Beruf – berufliche Laufbahn

Der Beruf trägt zur eigenen Identifikation und gesellschaftlichen Stellung bei. „Bedürfnis nach Sicherheit prägte den Berufswunsch der Nachkriegsgeneration. Bürgerliche Berufe gaben ein sicheres Auskommen und ein geregeltes Leben. Mit dem Wunsch nach Selbstverwirklichung strebten die 68ziger in den Fokus, neue kreative und soziale Berufsbilder etablierten sich am Markt und in der Gesellschaft. Die ideelle Selbstverwirklichung und parallel dazu die Emanzipation sorgten für neue Lebensentwürfe. Seit den siebziger Jahren hat die Jungend Wahlfreiheit. Damit eng verbunden ist die Erwartungshaltung, aus dem eigenen Leben sinnvolles zu gestalten. Dann mal los!“, fordert Norbert Hahn den Teilnehmerkreis sportlich auf.

Chance Azubi in der digitalen, hoch komplexen, flexibilisierten und globalisierten Welt?

Sich entscheiden, eine Wahl treffen ist schwierig und in jungen Jahren besonders schwer: „Der Schulabschluss rückt näher, was machen? Wozu habe ich Lust? Was macht Sinn und mich glücklich? Wo verdiene ich genügend? Wird der Beruf wegrationalisiert durch die Digitalisierung?“ Bekannte Fragen bei der Berufswahl. Zudem steigt der Erwartungsdruck, die Leistungsgesellschaft fordert und der Wunsch das Leben sinnvoll zu gestalten wird laut. Hahn Fertigungstechnik blickt auf eine jahrelange Unternehmenserfolgsgeschichte und Norbert Hahn kennt die Bedenken und Fragen der Jugend und deren Eltern. Formate wie Chance Azubi, Jobbörsen, Coachings von Arbeitsagenturen, Praktika und das ehrenamtliche Engagement liefern Unterstützung bei der Wahl. Entscheidend für junge Menschen ist, einen Einblick und Wissen über das Tun, Werken, Wirken und Handeln im Berufsalltag zu erfahren.

Was macht ein Feinwerkmechaniker im Berufsalltag? Wird produziert oder repariert, entwickelt oder nach Vorlage gefertigt? Wie gestaltet sich der Berufsalltag eines Feinwerkmechanikers?

Hahn Fertigungstechnik bildet den Beruf des Feinmechanikers aus. „Feinwerkmechaniker (m/w) stellen Werkstücke für Maschinen und feinmechanische Geräte her, reparieren und montieren diese und fertigen Stanz-, Umformungswerkzeuge und Stahlformen. Feinwerkmechaniker ist ein anerkannter Ausbildungsberuf nach der Handwerksordnung (HwO). Die Ausbildung ist bundesweit geregelt und dauert 3,5 Jahre“, ein kurze Berufsvorstellung. Aber was genau wird getan?

Grundlagen der Zerspanungstechnik: Spanbildung und Spanarten

Hahn Fertigungstechnik GmbH hat sich auf die Zerspanung spezialisiert. Die Spanbildung ist eine annähernd plastische Verformung des Werkstoffs. Der Schneidkeil dringt in den Werkstoff ein und Zerspanung wird hervorgerufen. Dabei wird der Werkstoff gestaucht bis die Stauchkraft so groß ist, dass die Scherung des Werkstoffs entlang der Scherebene, in dünne Lamellen bewirken wird.

Die Spanart ist vom Werkstoff und den Spanungsbedingungen abhängig. Norbert Hahn erläutert, dass die Schnittgeschwindigkeit, Vorschubgeschwindigkeit, Kühlung, Schmierung, Werkzeug, Werkstück-Kombination, Spanwinkel, Schnitttiefe, Schneidengeometrie und Werkzeug/Werkstück-Schwingungen unterschiedliche Spanarten benötigt und hervorruft.

Vier Unterscheidungen zur Entstehung und Struktur der Späne:

1. Fließspan: duktile Werkstoffe, hohe Schnittgeschwindigkeit, kleiner Spanwinkel, geringe Schnitttiefe
2. Lamellenspan: diese Spanart wird in der vollautomatischen Fertigung angestrebt
3. Scherspan: vollkommene Trennung der Späne in der Scherebene und anschließendes Wiederverschweißen; Vorteil geringe Verformbarkeit des Materials
4. Reißspan: spröde Werkstoffe, kleiner Spanwinkel, Spanteile werden von der Oberfläche abgerissen, es entsteht eine raue Oberfläche

Norbert Hahn betont, dass es beim Arbeitsergebnis im Bereich Fertigungstechnik auf jeden Millimeter ankommt. Computergesteuerte Werkzeugmaschinen, die bei spanenden Arbeiten wie Drehen, Bohren, Schleifen oder Fräsen zum Einsatz kommen, unterstützen die Feinwerkmechaniker. Die Feinwerkmechaniker bei Hahn Fertigungstechnik programmieren die Werkzeugmaschinen, führen die spanenden Arbeiten durch und überprüfen das Arbeitsergebnis mittels verschiedener Messwerkzeuge. Hahn Fertigungstechnik bietet von der Reparatur über die Konstruktion von Sonderanfertigungen bis zu Neuanfertigungen ein breites Leistungsspektrum an. Die Mitarbeiter sind Teil des gesamten Leistungsspektrums und gestalten vom Prototypenbau, der Einzelanfertigung bis zur Serienfertigung an den Lösungen mit.

Fazit: „Tun lernt“ – Blick in das Unternehmen – Berufswahl einfacher nach Praktikum treffen

„Der Unternehmenserfolg spiegelt sich in qualifizierte und gut ausgebildete Mitarbeiter wieder. Diese Mitarbeiter sorgen dafür, dass aus Ideen erfolgreiche Produkte und aus Problemstellungen der unterschiedlichen Kunden spezifische Problemlösungen werden. Deshalb ist uns sehr an einer qualifizierten Ausbildung unseres Nachwuchses gelegen“, betont Norbert Hahn. Hahn Fertigungstechnik freut sich auf Praktikanten. Persönlichen Einblick in den Alltag der Fertigungstechnik erleichtert die Berufswahl. Weitere Informationen unter www.hahn-fertigungstechnik.de.

Die Hahn Fertigungstechnik GmbH in Papenburg an der Ems in Niedersachsen wurde im Jahr 2000 gegründet und beschäftigt rund 40 Mitarbeiter. Hahn Fertigungstechnik GmbH ist ein mittelständiges Unternehmen und hat sich spezialisiert auf die Bearbeitung von anspruchsvollen Dreh- und Frästeilen. Von der Konstruktion bis zur Fertigung liefert Hahn Fertigungstechnik komplett bearbeitete, einbaufertige Teile oder komplexe Baugruppen aus allen zerspanbaren Materialien. Die Reparatur von Bauteilen ist Bestandteil unseres Leistungsspektrums. Gegenseitige Synergien der Unternehmen Hahn Fertigungstechnik und Maschinenbau Hahn werden in der Konstruktion, der Aus- und Weiterbildung, der Logistik und weiteren Bereichen genutzt. Weitere Informationen unter www.hahn-fertigungstechnik.de

Kontakt
Hahn Fertigungstechnik GmbH
Norbert Hahn
Dieselstraße 1
26871 Papenburg
+49 4961 9707-0
+49 4961 6224
office@hahn-fertigungstechnik.de
http://www.hahn-fertigungstechnik.de

Medizin Gesundheit Wellness

Die Sehnsucht nach Wahrheit und Liebe

und was uns sonst noch
in den Himmel zieht

Die Sehnsucht nach Wahrheit und Liebe

Cover

Orientierung auf dem geistigen Weg

„Wer bin ich?“, „Warum bin ich hier?“, „Was ist meine Aufgabe?“

Das eigene Wollen und Sehnen be-stimmt unser Voranschreiten. Im Buch werden sämtliche Themen und Inhalte behandelt, die für die indivi-duelle spirituelle Entwicklung wichtig sind. Es eignet sich sowohl zur Vorbereitung als auch als Wegbegleiter für das nicht immer leichte Unterfangen, dem inneren und äußeren Meister zu begegnen.

Möchte man spirituellen Fortschritt erlangen, ist es notwendig, Ego-Strukturen aufzulösen. Indem sie Herz und Verstand gleichermaßen berühren, geben die vorliegenden Ausführungen Impulse für den spiri-tuellen Weg und machen Mut, ihn weiter zu gehen.

Vollkommen undogmatisch und über-konfessionell bietet das Buch Frei-räume für individuelles und kreatives Vorgehen in jeder denkbaren Lebenssituation.

„Wenn wir uns auf den geistigen Weg einlassen, seriös und voll und ganz, entfällt das Zufallsprinzip für uns. Wir werden geführt und alles, was uns passiert, ist richtig für uns, ist Schulung, weist uns darauf hin, was wir zu lernen haben und was wir ändern müssen.“ (John Elissen)

Über den Autor

Nach einem bewegten Berufsleben als Schiffsoffizier, Kaufmann und Mitinhaber einer Dienstleistungsfirma zog John Elissen sich im Alter von 49 Jahren mit seiner Familie auf eine Insel im europäischen Ausland zurück. Der Wunsch nach einem natürlichen und einfachen Leben als Selbstversorger mit Bienen, Ziegen sowie eigenem Gemüse und Obst erfüllte sich für einen Zeitraum von über 20 Jahren. Dieser äußere Rahmen erwies sich als eine gute Vorbereitung für die Begegnung mit einem spirituellen Lehrer, der ihm den geistigen Weg eröffnete. Heute lebt er mit seiner Frau in ländlicher Abgeschiedenheit in Niedersachsen.

tao.de ist ein Selfpublishing-Portal, das AutorInnen mit den Themengebieten Neues Bewusstsein, Ganzheitliche Gesundheit und Spiritualität bei allen Schritten von der Idee über die Produktion von Büchern und ebooks bis zu ihrer Vermarktung begleitet. tao.de ist der Selfpublishing-Verlag der J.Kamphausen Mediengruppe.

Firmenkontakt
J.Kamphausen Mediengruppe GmbH
Kirstin Dreimann
Goldbach 2
33615 Bielefeld
0521-560520
0521-5605229
info@tao.de
www.tao.de

Pressekontakt
J.Kamphausen Mediengruppe GmbH
Julia Meier
Goldbach 2
33615 Bielefeld
0521-56052257
0521-5605229
julia.meier@j-kamphausen.de
www.tao.de

Kunst Kultur Gastronomie

Lebenskunst: Selbstverwirklichung ohne Selbstbezogenheit.

Zur Möglichkeit, den Egoismus zu überwinden.

Lebenskunst: Selbstverwirklichung ohne Selbstbezogenheit.

In seinem Buch „Weltformel Seele – Quantensprung der Evolution“ spürt Ronald Kahle den Steuerungsprozessen der Natur nach und legt dabei die Zielrichtung der Evolution frei. Egoismus ist das Resultat falsch verstandener Selbstverwirklichung und arbeitet nun dem Ziel des Lebens entgegen. Die weltweiten Krisen sind die Folge und drängen den Menschen zum Umdenken. Im Selbstverständnis des Menschen und in seinem Verhältnis zur Einheit der Natur liegt die Ursache der Problematik und auch der Schlüssel zu ihrer Überwindung verborgen.

Mit ihren Beschreibungen der elementaren Bausteine der Materie, zeichnet die Quantenphysik eine Welt der Einheit als Grundlage allen Bestehens. Der Mensch dagegen erlebt sich sinnesorganisch in einer Welt der Einzelobjekte. In einem Kampf um Macht und Autonomie stellt er seine Einheit der Einheit des Universums gegenüber. So prallen Innen- und Außenwelt im Spannungsfeld von Freiheit und Determination aufeinander. Das selbststeuernde System der Natur stellt den Menschen vor seine Eigenverantwortung, mit dem Ziel, ihn in einen bewussten, selbstschöpferischen Prozess hineinzuführen. Dazu wird dem Menschen aber eine sehr tiefgreifende Selbsterkenntnis abverlangt, denn er vermag den gestellten Anforderungen nur zu genügen, wenn es ihm gelingt von der biologisch bedingten, oberflächlichen Selbstbezogenheit durchzudringen zu seinem wahren Wesens- oder Seelenkern, der Anteil hat an der Welt der Einheit. Es ist der Quell seiner Sehnsucht und der Geburtenschoß der Ideale, den C. G. Jung als „Nicht-Ich-Zentrum“ charakterisiert, die Bibel als „Samenkorn Christi“ und Schiller als „Götterfunken“. Als Anknüpfungspunkt der Einheit ist dieser die Basis allen wahrhaft menschlichen Werdens.

In einem tief eingreifenden Seelenprozess sind die, infolge überspannter Selbstbezogenheit verworrenen Informationsstrukturen aufzulösen und im Geist der Einheit neu zu ordnen. Dabei wird hinter der scheinbaren Irrationalität des Lebens und den komplementären Polaritäten der Natur eine regenerative Ordnungsstruktur sichtbar, die den Menschen in einer zielgerichteten Evolution aus der relativistischen Welt subjektiver Erscheinungen zum wahrhaften Sein der Einheit führen will.

„Weltformel Seele – Quantensprung der Evolution“ ist als flott geschriebenes populärwissenschaftliches Sachbuch abgefasst, das zu tiefem Nachdenken anregt.

Autor:
Als Ingenieur im naturwissenschaftlich-physikalischen Bereich zu Hause, hat sich der Autor über 30 Jahre im Rahmen einer modernen Philosophenschule ernsthaft in Theorie und Praxis mit den elementaren Lebensfragen der Menschheit auseinandergesetzt. Die nüchterne Denkweise fordert dabei mit der Wissenschaft vereinbare Aussagen, das fühlende Herz zugleich – und auf Augenhöhe mit dieser – eine ganzheitliche Sichtweise und einen praktikablen Weg für jedermann.

Ronald Kahle
Weltformel Seele – Quantensprung der Evolution
Sachbuch, populärwissenschaftlich
Tredition, Hamburg
1. Auflage, 2015, 428 Seiten
ISBN 978-3-7323-1185-9
EUR 19,95
Auch als Hardcover und e-Book.
https://tredition.de/publish-books/?books/ID42153/Weltformel-Seele

Weitere Informationen:
http://weltformelseele.jimbo.com

Text:
Ronald Kahle

Die tredition GmbH ist ein Hamburger Unternehmen, das Verlags- und Publikations-Dienstleistungen für Autoren, Verlage, Unternehmen und Self-Publishing-Dienstleister anbietet. tredition vertreibt für seine Kunden Bücher in allen gedruckten und digitalen Ausgabeformaten über alle Verkaufskanäle weltweit (stationärer Buchhandel, Online-Stores) mit Einsatz von professionellem Buch- und Leser-Marketing.

Der 2006 gegründete Anbieter ist darauf spezialisiert, durch das Optimieren von Auflagenmanagement, Vertrieb und Abrechnungswesen die Erträge für Verlage, Unternehmen und Autoren zu maximieren. tredition ist Preisträger des Webfuture Awards der Hansestadt Hamburg und erhielt den Förderpreis des Mittelstandsprogramms. Darüber hinaus gewann das Unternehmen den Preis Digitale Innovation Pitch (BUIDP). Neben privaten Autoren auf seinem eigenen Self-Publishing-Portal tredition.de hat tredition auch Unternehmen wie brand eins, Hamburger Abendblatt, Hamburger Morgenpost, Neue Westfälische, Bucerius Law School, kress, CHIP oder Der 2006 gegründete Anbieter ist darauf spezialisiert, durch das Optimieren von Auflagenmanagement, Vertrieb und Abrechnungswesen die Erträge für Verlage, Unternehmen und Autoren zu maximieren. tredition ist Preisträger des Webfuture Awards der Hansestadt Hamburg und erhielt den Förderpreis des Mittelstandsprogramms. Darüber hinaus gewann das Unternehmen den Preis Digitale Innovation Pitch (BUIDP). Neben privaten Autoren auf seinem eigenen Self-Publishing-Portal tredition.de hat tredition auch Unternehmen wie brand eins, Hamburger Abendblatt, Hamburger Morgenpost, Neue Westfälische, Bucerius Law School, kress, CHIP oder die Kamphausen Mediengruppe im Kunden-Portfolio.

Firmenkontakt
Autor bei Tredition
Ronald Kahle
Grindelallee 188
20144 Hamburg
040-41 42 778 00
040-41 42 778 01
info@tredition.de
http://www.tredition.de

Pressekontakt
Tredition
Nadine Otto
Grindelallee 188
20144 Hamburg
040-41 42 778 00
040-41 42 778 01
presse@tredition.de
http://www.tredition.de